PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 512aa    MW: 57311.5 Da    PI: 6.5281
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638377.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-1591137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEde l +av  +  ++Wk+Ia+ ++  Rt+ qc +rwqk+l
   XP_013638377.1  91 KGGWTTEEDETLRRAVCTYNAKSWKKIAEFFP-DRTEVQCLHRWQKVL 137
                      688*****************************.************986 PP

2Myb_DNA-binding635.9e-20143189148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde++v++vk++G+  W+tIa+ +  gR +kqc++rw+++l
   XP_013638377.1 143 KGPWTQEEDEKIVELVKKYGPAKWSTIAKSLE-GRIGKQCRERWHNHL 189
                      79******************************.*************97 PP

3Myb_DNA-binding57.72.6e-18195238146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT+eE++ l +a++ +G++ W+ Ia+ ++ gRt++++k++w++
   XP_013638377.1 195 KEAWTPEEELALMNAHRVHGNR-WAEIAKVLP-GRTDNSIKNHWNS 238
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.89786137IPR017930Myb domain
SMARTSM007171.7E-1390139IPR001005SANT/Myb domain
PfamPF002493.0E-1491137IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-1692147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-2293149IPR009057Homeodomain-like
CDDcd001679.65E-1294137No hitNo description
PROSITE profilePS5129432.292138193IPR017930Myb domain
SuperFamilySSF466891.76E-32140236IPR009057Homeodomain-like
SMARTSM007178.6E-18142191IPR001005SANT/Myb domain
CDDcd001674.05E-15145189No hitNo description
PfamPF139218.2E-18146204No hitNo description
Gene3DG3DSA:1.10.10.605.4E-27150196IPR009057Homeodomain-like
SMARTSM007172.5E-17194242IPR001005SANT/Myb domain
PROSITE profilePS5129423.071194244IPR017930Myb domain
CDDcd001675.50E-13197240No hitNo description
Gene3DG3DSA:1.10.10.601.8E-23197243IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MSFNFNPSSS SSPPPPPDEG ERGEEVKKME EEEEDECVEN KQSTAASCSS VSEGSGGGGG  60
SSFLKSPPAV ASPPTVSPTH RRTSGPIRRA KGGWTTEEDE TLRRAVCTYN AKSWKKIAEF  120
FPDRTEVQCL HRWQKVLNPD LIKGPWTQEE DEKIVELVKK YGPAKWSTIA KSLEGRIGKQ  180
CRERWHNHLN PGINKEAWTP EEELALMNAH RVHGNRWAEI AKVLPGRTDN SIKNHWNSSL  240
KKKSEFYQAN GALPPSAAKN GVLDSATKRP LFYQRRDSAI QINKPDEDGR HQLNSSAPLE  300
EVVAASPLTS DQLPRPEPSP ENGYHIYYKN HQTEYSMASE ADKQRMYGYE CGCSPSASPV  360
IFFTPPPPSR KEYFNGLRPT SPESYLREAA RTFPNTPSIF RKRRRRTVVV VSDSDNKAAK  420
TDEETAKEAV VVVDQKVNEI SESPDCEEEK EGNDGSNAYN LSPPYRIRSK RTAVFKSRQL  480
EFISPEEEKA DDDTKSSEKD KVLDGGDSQL PV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-70902435158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-70902435158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400404RKRRR
2400406RKRRRRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638377.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0D3CLP90.0A0A0D3CLP9_BRAOL; Uncharacterized protein
STRINGBra029762.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.10.0myb domain protein 3r-3